Web Analysis for Diyarbakirevdenevenakliyatfirmalari - diyarbakirevdenevenakliyatfirmalari.com
3.45
Rating by CuteStat
diyarbakirevdenevenakliyatfirmalari.com is 5 years 5 days old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, diyarbakirevdenevenakliyatfirmalari.com is SAFE to browse.
PageSpeed Score
38
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 18,100,000 |
Bing Backlinks: | 21 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 1 |
H3 Headings: | Not Applicable | H4 Headings: | 6 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 13 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 185.12.108.69)
Diyarbakır Evden Eve Nakliyat ÖZ DÜNYA EXPRESS Nakliyat 0 536 784 19 9
- ozdunyaevdeneve.com
diyarbakir Şehirlerarası Nakliyat Firmaları, diyarbakir Şehirlerarası Nakliyat Şirketleri, diyarbakir Şehirlerarası Nakliyat Fiyatları, diyarbakirda Nakliyat, diyarbakir şehirlerarası evden eve nakliyat, diyarbakir Şehirlerarası Ev Taşıma, diyarbakir Şehirlerarası Ev Taşıma Firmaları, diyarbakir Şehirlerarası Evden Eve
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Sat, 11 May 2019 12:12:47 GMT
Server: Apache
Last-Modified: Thu, 09 May 2019 12:18:06 GMT
Accept-Ranges: bytes
Content-Length: 13938
Content-Type: text/html
Date: Sat, 11 May 2019 12:12:47 GMT
Server: Apache
Last-Modified: Thu, 09 May 2019 12:18:06 GMT
Accept-Ranges: bytes
Content-Length: 13938
Content-Type: text/html
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.btsunucu.com | 185.12.108.12 | Türkiye | |
ns2.btsunucu.com | 185.12.108.13 | Türkiye |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
diyarbakirevdenevenakliyatfirmalari.com | A | 10799 |
IP: 185.12.108.69 |
diyarbakirevdenevenakliyatfirmalari.com | NS | 14400 |
Target: ns1.btsunucu.com |
diyarbakirevdenevenakliyatfirmalari.com | NS | 14400 |
Target: ns2.btsunucu.com |
diyarbakirevdenevenakliyatfirmalari.com | SOA | 10798 |
MNAME: ns1.btsunucu.com RNAME: teknik.ynt.com.tr Serial: 2019050903 Refresh: 3600 Retry: 1800 Expire: 1209600 Minimum TTL: 86400 |
diyarbakirevdenevenakliyatfirmalari.com | MX | 14400 |
Target: diyarbakirevdenevenakliyatfirmalari.com |
diyarbakirevdenevenakliyatfirmalari.com | TXT | 14400 |
TXT: v=spf1 +a +mx +ip4:185.12.108.69 ~all |
Full WHOIS Lookup
Domain Name: DIYARBAKIREVDENEVENAKLIYATFIRMALARI.COM
Registry Domain ID: 2388928576_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-09T05:51:15Z
Creation Date: 2019-05-09T05:47:59Z
Registry Expiry Date: 2020-05-09T05:47:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BTSUNUCU.COM
Name Server: NS2.BTSUNUCU.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-11T12:12:53Z
Registry Domain ID: 2388928576_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-09T05:51:15Z
Creation Date: 2019-05-09T05:47:59Z
Registry Expiry Date: 2020-05-09T05:47:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BTSUNUCU.COM
Name Server: NS2.BTSUNUCU.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-11T12:12:53Z