3.45 Rating by CuteStat

diyarbakirevdenevenakliyatfirmalari.com is 5 years 5 days old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, diyarbakirevdenevenakliyatfirmalari.com is SAFE to browse.

PageSpeed Score
38
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 18,100,000
Bing Backlinks: 21

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

185.12.108.69

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: 6
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 13
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 185.12.108.69)

Diyarbakır Evden Eve Nakliyat ÖZ DÜNYA EXPRESS Nakliyat 0 536 784 19 9

- ozdunyaevdeneve.com

diyarbakir Şehirlerarası Nakliyat Firmaları, diyarbakir Şehirlerarası Nakliyat Şirketleri, diyarbakir Şehirlerarası Nakliyat Fiyatları, diyarbakirda Nakliyat, diyarbakir şehirlerarası evden eve nakliyat, diyarbakir Şehirlerarası Ev Taşıma, diyarbakir Şehirlerarası Ev Taşıma Firmaları, diyarbakir Şehirlerarası Evden Eve

Not Applicable $ 8.95

Index of /

- edmyapimimarlik.com
Not Applicable $ 8.95

Turkey Haberleri

- turkeyhaberleri.com
Not Applicable $ 8.95

Haber 181 En Son Haberler

- haber181.com
Not Applicable $ 8.95

Index of /

- eliteakademidiyarbakir.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 11 May 2019 12:12:47 GMT
Server: Apache
Last-Modified: Thu, 09 May 2019 12:18:06 GMT
Accept-Ranges: bytes
Content-Length: 13938
Content-Type: text/html

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: May 9, 2019, 12:00 AM 5 years 5 days 9 hours ago
Last Modified: May 9, 2019, 12:00 AM 5 years 5 days 9 hours ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.btsunucu.com 185.12.108.12 Türkiye Türkiye
ns2.btsunucu.com 185.12.108.13 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
diyarbakirevdenevenakliyatfirmalari.com A 10799 IP: 185.12.108.69
diyarbakirevdenevenakliyatfirmalari.com NS 14400 Target: ns1.btsunucu.com
diyarbakirevdenevenakliyatfirmalari.com NS 14400 Target: ns2.btsunucu.com
diyarbakirevdenevenakliyatfirmalari.com SOA 10798 MNAME: ns1.btsunucu.com
RNAME: teknik.ynt.com.tr
Serial: 2019050903
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
diyarbakirevdenevenakliyatfirmalari.com MX 14400 Target: diyarbakirevdenevenakliyatfirmalari.com
diyarbakirevdenevenakliyatfirmalari.com TXT 14400 TXT: v=spf1 +a +mx +ip4:185.12.108.69 ~all

Full WHOIS Lookup

Domain Name: DIYARBAKIREVDENEVENAKLIYATFIRMALARI.COM
Registry Domain ID: 2388928576_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-09T05:51:15Z
Creation Date: 2019-05-09T05:47:59Z
Registry Expiry Date: 2020-05-09T05:47:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BTSUNUCU.COM
Name Server: NS2.BTSUNUCU.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-11T12:12:53Z